Protein Info for DVUA0022 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00005: ABC_tran" amino acids 26 to 175 (150 residues), 113.9 bits, see alignment E=4.5e-37

Best Hits

Swiss-Prot: 41% identical to YBBA_SHIFL: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Shigella flexneri

KEGG orthology group: K02003, (no description) (inferred from 100% identity to dvl:Dvul_3084)

MetaCyc: 40% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WR7 at UniProt or InterPro

Protein Sequence (228 amino acids)

>DVUA0022 ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEARTLLEVHGVSMVFGAGENAQYALRDVHLSVRDGEVLMLRGPSGSGKTTLLSIMGGIL
SPTEGTLTVDGTPMTGLSAEARSALRLKHFGFIFQDYNLFPTLTCSQNIQVALDLRGVPR
DEARRIADATLGEVGLGGKVGEMPARLSGGQKQRLAVARALAGSPMVMLADEPTAALDST
NGLMIMSLLRDLAHAGGRAVVVVTHDDRIMPFADRVVHIEDGRIKETE