Protein Info for DVUA0036 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 915 PF13432: TPR_16" amino acids 59 to 123 (65 residues), 31.7 bits, see alignment 1.8e-10 amino acids 195 to 258 (64 residues), 37.1 bits, see alignment 3.5e-12 amino acids 303 to 358 (56 residues), 24.3 bits, see alignment 3.7e-08 amino acids 330 to 394 (65 residues), 36.4 bits, see alignment 6e-12 amino acids 368 to 425 (58 residues), 27.1 bits, see alignment 4.8e-09 amino acids 398 to 461 (64 residues), 18.9 bits, see alignment 1.7e-06 amino acids 739 to 795 (57 residues), 20.1 bits, see alignment 7.7e-07 amino acids 845 to 896 (52 residues), 23.7 bits, see alignment 5.7e-08 PF14559: TPR_19" amino acids 65 to 113 (49 residues), 32.6 bits, see alignment 8.9e-11 amino acids 337 to 397 (61 residues), 29.8 bits, see alignment 6.6e-10 amino acids 845 to 907 (63 residues), 27 bits, see alignment 5e-09 PF13181: TPR_8" amino acids 91 to 122 (32 residues), 14.5 bits, see alignment (E = 3.6e-05) amino acids 327 to 358 (32 residues), 15.8 bits, see alignment (E = 1.3e-05) amino acids 729 to 761 (33 residues), 12.5 bits, see alignment (E = 0.00015) PF13428: TPR_14" amino acids 91 to 132 (42 residues), 23.5 bits, see alignment 6.3e-08 PF13174: TPR_6" amino acids 329 to 354 (26 residues), 13.1 bits, see alignment (E = 0.00014)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0036)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WQ3 at UniProt or InterPro

Protein Sequence (915 amino acids)

>DVUA0036 TPR domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDAPGPKPLRVARYWLYTGEHPARTTEVPVWNKLCLSVCCAILVLTASSCGADKSSDFLT
EGRKLMDAGNAAGAVVLFRNALEKTPADYTLHLELGRAYIALGKLDLAEGELQKCLRQQP
DDPPLNLALGELYVARNEPAKALPHLARYEQGAGETAVSRELAGLAHAQARSPEEARAAL
ERSIALDAKRVTPRLALARLFLYRGDLKRAVATVDEALAVAPEDRLALTLRGDLLLRQGD
APGALVVFRKVASLAPGDDYARYMSGLLALQTGDEAGAAAVAASMNKDFKDNSLTLMLDG
ALAAQRKDYTLAASLFQRSVAMRPSLEGYYKLGMALYGKGDLETALSQFNRVLEATPEYD
AARRMTVTILLAQRRVAEARQEAQKLVERNPSDAAAHFMLASAQMAAGDRAGAERSFEAG
LALQPAHVPALLQLSRLKQADGRPDEALEDLKAAVVAAPDDLAVRNALFAYHLGRGDTGK
GVQVVLEGLRGTPQDAILYTMLVPVYVNMGDEAKGLDAVAQAHRADPDFPDAYLAGLRLH
AGAGRAEQALAESEAYLARKPDAPGFLLASGALLDLLGRTAEADARFDKALAANDPRVSF
AVAERAVASGQDEKARRVLEEALRQHDQTTLRDALAIQLARMGKPDDALALYTAIETQRP
REALLGRYRLLTHLDRHQEAADTARELGRRESASPLPVLLEAAAFERMGQRPQGVALLEA
AHRKSGDPELLLAMGGMLERNGDEARAETCYRDALKARPDHVPTLLAYAGLDMRRKEYAK
ATALYEKAVSIAPDDVVALNNLAMAYLEKASRDATPQKALRLALQAYTRAPDNPAVLDTL
GVCMMANGRADDAARAFGRAVVAVPGNPSLRYRHAEALFKAGRKDMAAEELRAALQTPDF
PEAAKARDLLRKTGN