Protein Info for DVUA0051 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl transferase, group 1 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF13439: Glyco_transf_4" amino acids 16 to 173 (158 residues), 58.3 bits, see alignment E=3e-19 PF13579: Glyco_trans_4_4" amino acids 16 to 169 (154 residues), 46.5 bits, see alignment E=1.6e-15 PF00534: Glycos_transf_1" amino acids 262 to 426 (165 residues), 130 bits, see alignment E=2.1e-41 PF13692: Glyco_trans_1_4" amino acids 274 to 412 (139 residues), 123.3 bits, see alignment E=2.8e-39 PF20706: GT4-conflict" amino acids 277 to 388 (112 residues), 28.4 bits, see alignment E=2.6e-10 PF13524: Glyco_trans_1_2" amino acids 358 to 441 (84 residues), 44.9 bits, see alignment E=3.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0051)

Predicted SEED Role

"Glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WN8 at UniProt or InterPro

Protein Sequence (462 amino acids)

>DVUA0051 glycosyl transferase, group 1 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRRPRVCMLLATDRLGGPGKGLVQFLRHGGLAGCSPVVVAYEAGEPGETEFTRAVRDTGA
DLRILRQRGAFDVSLIPQALRVVRDEGCEVLQSHGYKSHAVCACLHAMTGLPWVAFVHGW
TAENVRVRAYRVLEQALLPLATRVVAVSDALGRSVWPAARRRMVVIPNAIDPAEALRDGD
VPATGPHSGAHPDAFAQVPQVPGGASQPEAGDPAEALRDGDVPATGLYASPDASPDASPD
ASPDASPDANHDTGSDAGKGDLRAAFGIAADALVAGVVGRLSPEKGHIHFLRALARARQT
EPRLVGLLAGDGPGADMLRREADMLGLAHAVTFAGHVSRVARVYRALDVAVLPSLSEGMP
NAALEAMLHGLPVVASHVGGVPEVVRDGETGLLVPPGDEAQLAAALVALCADVERRKVLG
ARGRERVLGHFAPHQRAERILGLYHELLQPLAGEGQRHAKLG