Protein Info for DVUA0054 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl transferase, group 1 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 PF13579: Glyco_trans_4_4" amino acids 41 to 166 (126 residues), 48.2 bits, see alignment E=4.7e-16 PF13439: Glyco_transf_4" amino acids 50 to 171 (122 residues), 70.4 bits, see alignment E=6e-23 PF00534: Glycos_transf_1" amino acids 226 to 380 (155 residues), 133 bits, see alignment E=2.6e-42 PF13692: Glyco_trans_1_4" amino acids 231 to 368 (138 residues), 121.7 bits, see alignment E=8.6e-39 PF20706: GT4-conflict" amino acids 243 to 374 (132 residues), 38.4 bits, see alignment E=2.3e-13 PF13524: Glyco_trans_1_2" amino acids 310 to 390 (81 residues), 52.6 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0054)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WN5 at UniProt or InterPro

Protein Sequence (466 amino acids)

>DVUA0054 glycosyl transferase, group 1 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRPHVMQLIFRLAPGGAERLALTTLDKAGSMIRGSVCGLFGHTGPLVAELEQRRIPWFGL
DVIGRSRLPGIMRLAALLRRQRVDVLHVQAAYLLQWAAPAAWLTGTRLVYTEHSSHTFET
QPRMARLVRWMAPFLGGMSCVTERLRRYMTDRMGIAPHRVRLIRNGVDVERFSPHGPVAP
LPDGWAHAAAPASADHGDHGDGAGDAASTGPAAPARRPDGAASGDSGDRVVIGNVARFCE
AKDHPGLLRAFHDVQSTHPAARLLLVGDGETRPQAEALRDALALGGTVHFAGTRQDVPAL
LRAMTVFVLSSRHEGMPVAVLEAMACGVPVVTTDVGGIGELVRDGETARIVPPGDPQALA
DALRWMLDHPAERMAMRDRALAMVRARCGHDVMVRGYLDLYGVADASSFALPRTGYATVS
PASASVSASRISEPAPRTSESTSRTSESTPRTSGPTAPSPDRRNRP