Protein Info for DVUA0065 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 59 to 81 (23 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details TIGR02916: putative PEP-CTERM system histidine kinase" amino acids 33 to 672 (640 residues), 403.6 bits, see alignment E=9.5e-125 PF02518: HATPase_c" amino acids 573 to 674 (102 residues), 71.2 bits, see alignment E=5.1e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0065)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WM4 at UniProt or InterPro

Protein Sequence (678 amino acids)

>DVUA0065 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTIVLACLVVVLTVAGTARALHESGRAAAPRVVAPVLTAVLVVAETYLAVATEVAPWTLQ
ATLILQALLAPAWATFALCYGRECSWRTLPRSGRLLLALSLSPVLMAAVLPPDQLFYLAD
FTAERVFYLEPRAFFLYLQLLLCLLLSAGNLETTLRNSRHSQRWRIKLALVGMGAVLAAL
CLQYGQGLVIRTLDLGYVGLRNGAVALGFALFLFAETRRGSDKVHIARRLAFRSVVAIIA
GGYLLGLGVLREGVRLAGPDFERHFALAIVFAVVLAGLIILLSDHLRRRFSIWMHRTFYN
EKYDYRTQWINFTDMLSHARNTRDFVDVMLVGLCDAFGFVGAAFVPADFEHPGQARDAVV
YEMEPLPPTLPATAFGGLLVYEGGPCTLDTVAGLLSEDALEALQDAGVGLVLPVRTVEGC
EGVVLLARPIDTREEHDLEDFELLEAMGRQIALCVRSFRLGDELAVAREMEALGRFAALV
MHDLKNQVYALSLLVDNARLYIAEPEFQRDLVETLTNSVSNMRNLISQLTRLPGRENLHL
APVDLMELAREACASLPGADIRFEGAGVRAAVDAEQVSKVLVNLCLNAIEADPAGPVVVR
VGVNGGPLIKVEDSAGGIDPALLRDGLFKPFRSTKKRGMGIGLYHCRKIVEAHGGTIGVE
SQPGRGSTFTVQFARREG