Protein Info for DVUA0068 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 283 to 308 (26 residues), see Phobius details amino acids 310 to 310 (1 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 385 to 402 (18 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details amino acids 507 to 528 (22 residues), see Phobius details amino acids 539 to 562 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0068)

Predicted SEED Role

"FIG00605536: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WM1 at UniProt or InterPro

Protein Sequence (660 amino acids)

>DVUA0068 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPSRYAWKDAIGIILVIGTVFCLSYTIGANAWWYSKEAIHDDACTLGHSFTMGLDFDLDY
MNEVSLGKYAKSYRGTPPVPPGIGVLSAPFVAFFSIFDRMAEHPVIQNHAQYFGSWAFFA
VGLSSSFYFLMGAYLYYRGLRSLIDISPAFVFLLCTGTGILFYVLMRPLMAHAFEFFNYA
LCFFASVQLYREESRRQWLYALLAAIAVTLAWLTRLHAIFPVLFPPLALLGLMLTMQTFD
RRTFLAKTAQYVLALVPCFAVAIALMYGIYAGPAPKLDSYGNIYSYVPVYTTFIAFVGDV
IALVASRLALLPVILVGNSFPLWCFMPIAFFGVGALLFHGGTSARRHGQRTLWIAWTLLA
VLYMAGPIAAVLLWRMPGSAYGFRYLYPLVPLGFLGFTLWRLRAGAQKSVVSRVVIAALL
VTSIFGTLAPVAFNSNPAWGYTQSPINEFGLKEGVSARDNLYRTIAWMEHPSFLRVAIGY
GPAFAFLPRTSPEVAGKQAFIHANTYAQVYIMCALWATVALAFAFHALRNKPAQHGARVS
AISFIPVMVVFLSIWHICFVYYQHRPEVASKLLEHAASLRDTIEAERKEKGSYPVQQDFL
PIETAENNVQFLYRSDGTNYKLIVLNAPDANVVTLFHPDERDPSRPWWAYGYWTKDARKW