Protein Info for DVUA0081 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl transferase, group 1/2 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 704 PF13641: Glyco_tranf_2_3" amino acids 39 to 221 (183 residues), 71.5 bits, see alignment E=4.3e-23 PF00535: Glycos_transf_2" amino acids 42 to 166 (125 residues), 112.4 bits, see alignment E=9.9e-36 PF10111: Glyco_tranf_2_2" amino acids 43 to 138 (96 residues), 50.6 bits, see alignment E=8.8e-17 PF13439: Glyco_transf_4" amino acids 354 to 510 (157 residues), 78 bits, see alignment E=4.1e-25 PF13579: Glyco_trans_4_4" amino acids 354 to 508 (155 residues), 76.1 bits, see alignment E=1.8e-24 PF13477: Glyco_trans_4_2" amino acids 405 to 455 (51 residues), 27.8 bits, see alignment 1.2e-09 PF00534: Glycos_transf_1" amino acids 522 to 678 (157 residues), 101.8 bits, see alignment E=1.5e-32 PF13692: Glyco_trans_1_4" amino acids 526 to 664 (139 residues), 95.5 bits, see alignment E=1.6e-30 PF13524: Glyco_trans_1_2" amino acids 613 to 692 (80 residues), 36.4 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0081)

Predicted SEED Role

"Beta-1,3-glucosyltransferase" in subsystem LOS core oligosaccharide biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WK8 at UniProt or InterPro

Protein Sequence (704 amino acids)

>DVUA0081 glycosyl transferase, group 1/2 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHCDDVMLPAALHRESCPAPEGVVTVADTTRNASGHARPRISIIIPAWNIAPWIGQTLRS
ILSQTVDDFECIVIDDGSTDGTAQVVASVADPRIRCIRQPNAGVSAARNRGIAEAQGAFI
TFLDGDDYWLPCFLETLLPPLLTRPEVDLVYCGMTMFMDDDGTVKPQPWGNVHATGNVWW
DMLSDSVMLMGAWLARAEVVKGCRPFDPTLRVGEDRDFLLSMLEDIYHQRHHEAVGIDAR
LLRYRQRRGSGVRQVADALQCEWHMMDRHLRHEGIPPAVRRRAYSDLAFKMGVIAAFGAR
DIALALRWYGKAFALCPMNGNLYWLPLRKMFLSLRPRRRLHMKVLFLSARADFGGGPEHV
LQLLRRLPPDVEAAVACPEDVPYWERFRNIVGDDNMFSMPHRAFTLEAVARLRRFCRKRG
FDVLHAHGKGAGLYARVLSLLCGIPSVYTFHGVHLGGYGPLKRWLYGAYERAASWCTRRG
IAVSRGERDAIEAHGLMPASKVSVIMNGVEMPEGTAPRPAGPPWLVVSFSRFDMQKNSLF
LLDVARALQEQGRLDGFRFLLVGDGPDRARLLEQAAAQGLGDRVSCPGATPTPHEAYAGA
LCYFSSSRWEGMPLAVLEAMAHGLPVVATDVVGNRDAVADGVTGLLYPEGDAGAAARGLV
RLADEAALWAAMAHEARAWVATRHDVQRMADRTFHELRKACGRA