Protein Info for DVUA0099 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HAMP domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 389 to 412 (24 residues), see Phobius details PF00672: HAMP" amino acids 407 to 465 (59 residues), 27.4 bits, see alignment 3.5e-10 PF07228: SpoIIE" amino acids 531 to 724 (194 residues), 164.2 bits, see alignment E=3.5e-52

Best Hits

KEGG orthology group: K07315, sigma-B regulation protein RsbU (phosphoserine phosphatase) (inferred from 100% identity to dvu:DVUA0099)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WJ0 at UniProt or InterPro

Protein Sequence (727 amino acids)

>DVUA0099 HAMP domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPAMTISLRTKLFLLVACSIALATVPIISFTYRDLRQSNAELEREAFGNVITLMEDGIDS
RYLNLLSNKVVDVLLRKEQLRRFTQLARATWQDVAQMPPDVRERFVANWIGRLAEFGVHM
DIVDAQGRPRAGTGLLGTVLADPSRTDFKGRPVRSLLSPVLLPQDGEFAVLEASGGASAV
GASVASGTAAAPGAAIVDGLPLATAQGDTASSVPTGVQADAQADAQTPAPVASAATPATG
TAVAPSGAPMLVYFLPMPDGESVAVSALLLSDIEKQALFSEQQIIRSLQEKFATLKLSGS
GYIALLSGRGEVLAHEGNPLGRSDGTIPADALATARAQGRVEVVSAASSPLGQAIFRIAY
FKALDWYVVSAAPVAEIEAPTNALVRKLSFLAAIAVLVSLAATLGITARLIAPLRMLTRK
AHALSSLDFSAPDAATFAAEGLFTRRSDEVGQLARAFAFMGEALSRNVRALMETTAAKER
IQGELDAARDIQMGILPAPDACPVRPGFSAHAFLEPAKEVGGDLYDFLTAPDGRQVFVIG
DVSGKGVPAALFMAMVVTLCRYAVAQGLSPAEAMMRVNAQLAQNNPGCMFVTLFIAAFDP
QTGVLEYANGGHCQPCVVDCEGTAPPFELEGISGPMVGAFEDVDYEGFTATLEEGQTCLV
YTDGVTEAMNPALELFDMVRLHDVVAAHRASTPADMLTGVHEALLAFRGEAEQSDDITML
SFTRRKP