Protein Info for DVUA0102 in Desulfovibrio vulgaris Hildenborough JW710

Name: escT
Annotation: type III secretion inner membrane protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 15 to 252 (238 residues), 195.6 bits, see alignment E=5.2e-62 PF01311: Bac_export_1" amino acids 17 to 252 (236 residues), 176.5 bits, see alignment E=3.3e-56

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 100% identity to dvl:Dvul_3010)

Predicted SEED Role

"Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WI7 at UniProt or InterPro

Protein Sequence (271 amino acids)

>DVUA0102 type III secretion inner membrane protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLETILDQLAVYDHMLALLVGMPRLFVIAQVAPFMGGNVVSGQLRLVLVFACYLPLHPV
IVGQLPHGHIFDPSLMGHYGALLLKETLLGLLMGLLAGMAFWAVQSAGFLIDNQRGASMA
EESDPMSGEQTSPTGAFLLQVMMYLFYASGAFVAFLGLLYTSYEVWPVPSLTPLSWRADL
PLYFAGKVAWLMTHMLLLAGPIMVACLLADLSLGLVNRFASQLNVYVLAMPVKSAVASLL
LLLYFGALVAHAPGLYADFAGGLATLQGLLP