Protein Info for DVUA0103 in Desulfovibrio vulgaris Hildenborough JW710

Name: invX
Annotation: type III secretion protein, HrpO family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 86 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details PF01313: Bac_export_3" amino acids 6 to 76 (71 residues), 88.1 bits, see alignment E=1.5e-29 TIGR01403: type III secretion protein, HrpO family" amino acids 7 to 83 (77 residues), 111.7 bits, see alignment E=6.8e-37

Best Hits

Swiss-Prot: 57% identical to YSCS_YERPS: Yop proteins translocation protein S (yscS) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K03227, type III secretion protein SctS (inferred from 100% identity to dvu:DVUA0103)

Predicted SEED Role

"Type III secretion inner membrane protein (YscS,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WI6 at UniProt or InterPro

Protein Sequence (86 amino acids)

>DVUA0103 type III secretion protein, HrpO family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDSMPMTYAVKALYLVLMLSMPPIIVASVVGIVLSLIQAITQLQEQTLTFGVKLIAVVLT
LFLMGGWFGGELLRFADEIFVKFYLL