Protein Info for DVUA0123 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: anti-anti-sigma factor (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR00377: anti-anti-sigma factor" amino acids 1 to 104 (104 residues), 74.3 bits, see alignment E=3.3e-25 PF01740: STAS" amino acids 3 to 106 (104 residues), 74.3 bits, see alignment E=6.1e-25 PF13466: STAS_2" amino acids 11 to 96 (86 residues), 59.5 bits, see alignment E=3.2e-20

Best Hits

Swiss-Prot: 35% identical to BTRV_BORBR: Putative anti-sigma factor antagonist BtrV (btrV) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0123)

Predicted SEED Role

"Anti-sigma F factor antagonist (spoIIAA-2); Anti-sigma B factor antagonist RsbV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WG6 at UniProt or InterPro

Protein Sequence (111 amino acids)

>DVUA0123 anti-anti-sigma factor (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQIVTTERDGITVISLTGRMDATTVASFDEAWRTCLDNGARRIVVDLGGVEYISSAGLRG
ILSLLKASKAAKGGLAFCNVGQMVAEVFRISGFTSMLAVFPGLDEALASLA