Protein Info for DVUA0129 in Desulfovibrio vulgaris Hildenborough JW710

Name: cas3
Annotation: CRISPR-associated helicase Cas3 domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 PF01966: HD" amino acids 1 to 78 (78 residues), 28.2 bits, see alignment E=4e-10 TIGR01596: CRISPR-associated endonuclease Cas3-HD" amino acids 3 to 146 (144 residues), 86.6 bits, see alignment E=2.2e-28 PF04851: ResIII" amino acids 206 to 336 (131 residues), 25.5 bits, see alignment E=2.3e-09 TIGR01587: CRISPR-associated helicase Cas3" amino acids 213 to 536 (324 residues), 108.1 bits, see alignment E=5.1e-35 PF00270: DEAD" amino acids 214 to 372 (159 residues), 43.3 bits, see alignment E=6.6e-15 PF22590: Cas3-like_C_2" amino acids 424 to 518 (95 residues), 44.5 bits, see alignment E=3.4e-15

Best Hits

KEGG orthology group: K07012, (no description) (inferred from 100% identity to dvu:DVUA0129)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WG0 at UniProt or InterPro

Protein Sequence (702 amino acids)

>DVUA0129 CRISPR-associated helicase Cas3 domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MANLAATFAEAFGAREWGKAAGLLHDAGKATAQFTQRLEGRPVRVNHSICGARLAQEQGS
TCGLLLSYAIAGHHGGLPDGGLQDGQLHHRLKHERLPADVSPPSVDIRPDVLKPPFTCRP
EHPGFSLSFFTRMLFSCLTDADFLDTEAFCTPEKASARNGRSALGLVALRDALNTHLDTV
ERKALPSRVNDIRKTVLHDCRARASETPGLFSLTVPTGGGKTLSSMAFALDHAVTHGLRR
VIYAIPFTSIIEQNAKVFSDVFGQDNVLEHHCNYRSKDEPEEQGYDKWRGLAAENWDAPV
VVTTNVQFFESLFSNRPSRCRKLHNIARSVIVLDEAQAIPTEYLEPCLYALKELVGQYGC
TVVLCTATQPAVDDASLPERVRLHHVREIIADPQRLYTDLKRTEVTLAGRLTDAALAARL
DGHGQVLCIVGTKPQAQAVFSLLQEREGAFHLSTNMYPEHRRRVLGTIRQRLADRLPCRV
VSTSLIEAGVDVDFPVVYRAMAGLDSIAQAAGRCNREGRLPEPGQVVVYEPEKPARMPWM
QRCASRAQETLRTLPEADPLGLEAIRRYFGLIYDVQELDRKDIFKRLRGQVDRDMVFKFR
EIANDFRFIDDEGTALVIPTGPEVEDLVRRLRGCEFPRPVLRKLQQYSVTVRHRELEKLR
SAGAVEMIGDAYPVLRNLAAYSEDMGLCVDSVEVWQPEGLVS