Protein Info for DVUA0132 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: CRISPR-associated protein, TM1801 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 TIGR01595: CRISPR-associated protein, CT1132 family" amino acids 4 to 277 (274 residues), 312.2 bits, see alignment E=3.4e-97 PF05107: Cas_Cas7" amino acids 6 to 277 (272 residues), 378 bits, see alignment E=1.2e-117 TIGR02589: CRISPR-associated protein Cas7/Csd2, subtype I-C/DVULG" amino acids 7 to 289 (283 residues), 452.5 bits, see alignment E=6.1e-140

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0132)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WF7 at UniProt or InterPro

Protein Sequence (290 amino acids)

>DVUA0132 CRISPR-associated protein, TM1801 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTAIANRYEFVLLFDVENGNPNGDPDAGNMPRIDPETGHGLVTDVCLKRKIRNHVALTKE
GAERFNIYIQEKAILNETHERAYTACDLKPEPKKLPKKVEDAKRVTDWMCTNFYDIRTFG
AVMTTEVNCGQVRGPVQMAFARSVEPVVPQEVSITRMAVTTKAEAEKQQGDNRTMGRKHI
VPYGLYVAHGFISAPLAEKTGFSDEDLTLFWDALVNMFEHDRSAARGLMSSRKLIVFKHQ
NRLGNAPAHKLFDLVKVSRAEGSSGPARSFADYAVTVGQAPEGVEVKEML