Protein Info for DVU0636 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: response regulator/GGDEF domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF00072: Response_reg" amino acids 127 to 237 (111 residues), 72.8 bits, see alignment E=2.5e-24 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 253 to 415 (163 residues), 133.4 bits, see alignment E=3.2e-43 PF00990: GGDEF" amino acids 255 to 411 (157 residues), 121.7 bits, see alignment E=2.6e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2323)

Predicted SEED Role

"response regulator/GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EE2 at UniProt or InterPro

Protein Sequence (437 amino acids)

>DVU0636 response regulator/GGDEF domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQRVLIIEDSRSTARLIAQGVQEKVGLQCDIAASLAEARVLLAVEPSPYLVALCDLYLPD
APDGSVVDFVLATGTPAVVVSAHFDAGLRQTMLHKGITDYVVKRNPEDMQYLIRLVARLA
ANEGTEVLVVDDSPVWRAHIAALLRRQRLTVHLAADGVEALEVLEANRNIRLVLTDHFMP
RMDGETLTARIRRSRGIEDVAVLAVSSGEGAAAQFLKSGANDYVSKQAAFEELLCRVHMN
LDLLDLMRRNRELAERDELTGLYARRRFFERAADLHRHAARAGDAMAVVMLDVDHFKRVN
DTYGHVAGDLALRQLGMMLRRAFDEPVVAGRYGGEEFGLVVAGASVQGLPDRLEAFRHDV
ERLEVSLGDRMFWITISAGCLLASACGSTPDSLFARADALLYQAKQQGRNRVVVERDRDV
QGVQGVVCTDVEQGDMA