Protein Info for DVU0635 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: dolichyl-phosphate-mannose-protein mannosyltransferase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 159 to 188 (30 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 336 to 354 (19 residues), see Phobius details amino acids 366 to 383 (18 residues), see Phobius details PF13231: PMT_2" amino acids 58 to 210 (153 residues), 71.3 bits, see alignment E=5.6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2324)

Predicted SEED Role

"dolichyl-phosphate-mannose-protein mannosyltransferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EE3 at UniProt or InterPro

Protein Sequence (528 amino acids)

>DVU0635 dolichyl-phosphate-mannose-protein mannosyltransferase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MREHHHNLRHYTLYAATIITITTLVRFWFVASGQLDLVQDEAQYWDWTRRLQLSYYSKGP
LIAWLIGMWTGVFGDTELGVRFGALAGSALAQVMLFLGVGRLFGRPRLALLTLGVANTTP
LFMVAGVLMTTDGPLLLCWLGALLCIHAATRTPRATAPYLLLAMCMAVGVLAKYMMLAVA
AIACLHMWLLHRQRLLPQGVALRVVCACLAGAACGMLPILLWNAQNDWVGFKHVGTLAGV
TGKASKAFLRLDRLPEHLGAQLGVATPWWLLLMLGMAWRSLRIAWTGVVPPGEPAEAAGR
EEAVRQSSLLFCAFMPLWGVITLWSLHTRIYPNWPAMSYVGGIILAAAGVERLLDGLGAP
RWRRLVPLWFTLGACLFAAAHFQNTLPLPASLNPAARLKGWEDLGRELDRVRHGLPHPDR
VFFFSDAYDITAELAFYVPGKPFTFCADFGRRMSQYDLWPSPADKVGWDAVFVRRDGTSV
PRELLEMFDSAELYRYQSTHHGAPGRVFTVIVLRGFNGEWPRRSFRSF