Protein Info for DVU0625 in Desulfovibrio vulgaris Hildenborough JW710

Name: nrfA
Annotation: cytochrome c nitrite reductase, catalytic subunit NrfA, putative (Shelley Haveman)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF02335: Cytochrom_C552" amino acids 52 to 475 (424 residues), 412.9 bits, see alignment E=1.9e-127

Best Hits

Swiss-Prot: 100% identical to NRFA_DESVH: Cytochrome c nitrite reductase subunit NrfA (nrfA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03385, formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit [EC: 1.7.2.2] (inferred from 100% identity to dvu:DVU0625)

Predicted SEED Role

"Cytochrome c552 precursor (EC 1.7.2.2)" in subsystem Nitrate and nitrite ammonification or Soluble cytochromes and functionally related electron carriers (EC 1.7.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EF3 at UniProt or InterPro

Protein Sequence (524 amino acids)

>DVU0625 cytochrome c nitrite reductase, catalytic subunit NrfA, putative (Shelley Haveman) (Desulfovibrio vulgaris Hildenborough JW710)
MNNQKTFKGLRLAALGLVAVAAFTAGCSDVSTELKTPVYKTKLTAEEIRNSAFKPEFPKQ
YASYERNDETTVMTEYKGSVPFNKNDNVNPLPEGYRHAQPYLKNLWLGYPFMYEYREARG
HTYAIQDFLHIDRINRYAEKGGLPATCWNCKTPKMMEWVKESGDGFWAKDVNEFRDKIDM
KDHTIGCATCHDPQTMELRITSVPLTDYLVSQGKDPKKLPRNEMRALVCGQCHVEYYFNG
PTMGVNKKPVFPWAEGFDPADMYRYYDKHGDLQVKGFEGKFADWTHPASKTPMIKAQHPE
YETWINGTHGAAGVTCADCHMSYTRSDDKKKISSHWWTSPMKDPEMRACRQCHSDKTPDY
LKSRVLFTQKRTFDLLLAAQEVSVKAHEAVRLANEYQGAKAAGYDDLMIQAREMVRKGQF
FWDYVSAENSVGFHNPAKALDTLAQSQQFSQKAIDLAMEATQYGIGKDLSGDIKTIVPPI
LKMNRKLQQDPEFMKTHKWFQYLPVLPKADQVWDGQKRLVSAKQ