Protein Info for DVU0621 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent DNA-binding response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF00072: Response_reg" amino acids 4 to 109 (106 residues), 68.8 bits, see alignment E=1.6e-22 PF00158: Sigma54_activat" amino acids 136 to 302 (167 residues), 203.5 bits, see alignment E=6.5e-64 PF14532: Sigma54_activ_2" amino acids 137 to 307 (171 residues), 49.7 bits, see alignment E=1.7e-16 PF07728: AAA_5" amino acids 159 to 280 (122 residues), 33.3 bits, see alignment E=1.6e-11 PF00004: AAA" amino acids 160 to 278 (119 residues), 22.2 bits, see alignment E=6e-08 PF25601: AAA_lid_14" amino acids 308 to 384 (77 residues), 64.9 bits, see alignment E=1.7e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0621)

Predicted SEED Role

"sigma-54 dependent DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EF7 at UniProt or InterPro

Protein Sequence (465 amino acids)

>DVU0621 sigma-54 dependent DNA-binding response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARILVVDDESLVRILVADTAGGMGHEVLAAASLTEAEEKAAKGIDVVFLDVLLPDGNGL
ENVARFTRLPGTPEVIVITGHGSADGAETALRHGVWDYVQKPLKVQEVMLSLSRALAYRA
GRNSATGRRPLRRDAIVGDSPALREALDLVEEAAASTVNVLITGETGTGKELFARAVHAN
SARCESPLVTLDCASLTENLVESQLFGHVRGAFTGAERNSEGLLRQAHGGTLFLDEAGDL
PLAMQGSFLRALELRRFRPVGSAHEVSSDFRLVAATNKNLHEMTRLDLFRSDLLYRLRGL
TITLPPLRDRTADILPLCEHVIEGYCAQHGAPMKQMAGDFMETVERYAWPGNIRELRHAV
ERACTAAHDDSTLYARQLPVEVRVTVARATIPCASEVDHCMPAAEGHDGTPMTLRDYKAC
AERAYVTRLLDRHGADVRAAASEAGISRGHLYELVRKHGLARDGN