Protein Info for DVU0619 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent transcriptional regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00158: Sigma54_activat" amino acids 154 to 318 (165 residues), 225.4 bits, see alignment E=1.1e-70 PF14532: Sigma54_activ_2" amino acids 155 to 323 (169 residues), 56.3 bits, see alignment E=1.3e-18 PF07728: AAA_5" amino acids 176 to 294 (119 residues), 42.6 bits, see alignment E=1.8e-14 PF00004: AAA" amino acids 176 to 309 (134 residues), 31.3 bits, see alignment E=7.5e-11 PF25601: AAA_lid_14" amino acids 324 to 399 (76 residues), 89.6 bits, see alignment E=2.8e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2338)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EF9 at UniProt or InterPro

Protein Sequence (479 amino acids)

>DVU0619 sigma-54 dependent transcriptional regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRYVLAATMDPAALAVLPRCFTPDIDLELSRSTAGMKSRLAARAHDIALVDMDILCGGTT
TDYETIRQAVHGFRQQHPSVDLIVLARADAIRQAVDAVRAGAGNYLTYPLHPEEVRLVTQ
KLHESALVRSELDYLRDRLIQGRSGGDEGIVLDTRSPRMREVYDKIRLVAATRSTVLLTG
ETGTGKSLIARLIHSHSNRHGKRFISVHCGAIPEALVESELFGHEKGAFTGAIRKKPGRF
EIAEGGTIFLDEIGTIGPSVQIKLLNVLQDRCFQRVGGETVIRPDVRVVAATNEDLSTLC
AQGRFRRDLYYRLNVFPIDIPPLRERKEDILQLAEAFVRRCNPQRSRDIRAIHPDVIDAF
MRYDWPGNVRELENIIERACILEGGEVLSPEAFPAEFRGLPHAVRNRALDISLPLEAARR
HALDSFEREYLERALATSGGSIKGAAAIAGVTTRQIHKLMTRHSLKKEDFKPGSGRLKK