Protein Info for DVU0608 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: methyl-accepting chemotaxis protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details PF02743: dCache_1" amino acids 52 to 267 (216 residues), 97 bits, see alignment E=3.4e-31 PF17201: Cache_3-Cache_2" amino acids 152 to 282 (131 residues), 51.5 bits, see alignment E=2.4e-17 PF00672: HAMP" amino acids 302 to 353 (52 residues), 34.8 bits, see alignment 4.3e-12 PF00015: MCPsignal" amino acids 459 to 642 (184 residues), 160 bits, see alignment E=1.4e-50

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to dvu:DVU0608)

Predicted SEED Role

"methyl-accepting chemotaxis sensory transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EH0 at UniProt or InterPro

Protein Sequence (677 amino acids)

>DVU0608 methyl-accepting chemotaxis protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRWNLRNRFLVPIISILVFGMGVTAYIAYTTASRNLEAALMQSSILVRDMLSRELSTTVE
DSQSDIGSQAKRDEFARVLSDPTPEHTKKAVQALRDTLEEYSTYQSLAVVGPDGVVVASN
RQEDIGKVNLGSRDYFKTAIQGTPAVSDAVLSKVNNKPVFVVASPVKRDGRVIGVIYGAI
DLARFATEVIDPIRIGKTGYAFLVSKAGFIAAHPDKSHILTLNLKDEPWAAPMFRNPSGE
VEYTFKGKDKILVYTTEKRTGWQLAVTVDMDEINESVAAIRNTTLAVGIIMLLVTSVVVF
LIVRSIVNALNKGVDFARAVADGDLGQDLALTRQDEIGTLAEALRVMVRRLKEMIATSEA
KTQEAEEQTRKAEVATREAEAARAQAENARREGLLLAASQLEGIVERISSASEELSAQVE
QAARGSSTQLQRTTEAATAMEEMNASVMEIARNAAEAAESSEHARREADEGASVVGSVVE
AISDVDAKTGELKLSLDMLGTRAENIGQIMTVITDIADQTNLLALNAAIEAARAGEAGRG
FAVVADEVRKLAEKTMNATKEVGEAVRAIQSGTKDNIRGMDEAAMSVGRSTELASIAGDA
LARIVGLIEGSADQVRAIATASEEQSAASEQINRGTDEVNRIASETAGAMGECAKAMTEL
SAMTQELRSLIVKLKAA