Protein Info for DVU0598 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: carbon starvation protein A, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 228 to 245 (18 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 414 to 438 (25 residues), see Phobius details amino acids 444 to 462 (19 residues), see Phobius details PF02554: CstA" amino acids 4 to 146 (143 residues), 102.9 bits, see alignment E=1e-33 amino acids 153 to 280 (128 residues), 64.8 bits, see alignment E=3.3e-22 amino acids 301 to 428 (128 residues), 32.3 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2354)

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EI0 at UniProt or InterPro

Protein Sequence (473 amino acids)

>DVU0598 carbon starvation protein A, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPSMMYFFLSVAALIGGYMVYSRVVERMFGVDNCKATPACTMADGVDYVKLPPSKIFLIQ
LLNIAGLGPVFGPILGALYGPWALVWIVLGSIFAGGVHDYFSGMLSVRYEGKSVPDIVGY
NLGNGFKQFMRFFSVVLLLLVGVVFVTGPAKLLANLTDMTLMTWVIIIFAYYFLATVLPI
DQIIGRIYPLFAVILVIMAVGLTGAMIVKGYEFYPSAHFVNQHPTGLPLWPLMFITIACG
AISGFHATQSPMMARCVPDENCGRPIFYGSMIAEGVIALIWATLGMSFYPTPEALNAAIA
AGGPGKVVNDVSMTLMGPVGGILAILGVVVLPVTSGDTAFRSARLTIADVLNFSQKGNGA
RLMIALPLFVIGAVLSQVNFDIIWRYFGWANQTLATIVLWASAAYLVRRGMLHWIASVPA
TFMTCVCVTYICYAKIGLNIPLDISTWIGIAAAVGSLGLFLVKRPAFAANPVA