Protein Info for DVU0562 in Desulfovibrio vulgaris Hildenborough JW710
Annotation: ISD1, transposase OrfA (TIGR)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to LCRS_YERPS: Low calcium response locus protein S (lcrS) from Yersinia pseudotuberculosis serotype I (strain IP32953)
KEGG orthology group: K07497, putative transposase (inferred from 98% identity to dba:Dbac_1235)Predicted SEED Role
"Mobile element protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q72EL6 at UniProt or InterPro
Protein Sequence (88 amino acids)
>DVU0562 ISD1, transposase OrfA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710) MKKSRFSESQIIRILKEADGGRKVVDICRENGVSQATYYQWKAKFGGMEASDIRRLKELE EENSKLKRMFANLSLENEALKDVIAKKL