Protein Info for DVU0548 in Desulfovibrio vulgaris Hildenborough JW710

Name: livH
Annotation: high-affinity branched-chain amino acid ABC transporter, permease protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 286 (277 residues), 147 bits, see alignment E=3.2e-47

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to dvl:Dvul_2396)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EM9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>DVU0548 high-affinity branched-chain amino acid ABC transporter, permease protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDWQYFCELLFGGLTRGSIYALIALGYTMVYGIIELINFAHGEVYMIGAFTALIVAGVLG
IYGFPEAGILIIAAIVAVIYCAAYGFTLEKVAYKPLRDAPRLSPLISAIGMSIFLQNYVI
LAQTSDFVPFPRLVPDLAILEPIAHITGTSDVLIIVTSAITMVGLTLFIKYTRMGKAMRA
TAQNRKMAMLLGIDADRVISLTFIIGSSLAAIGGVLIASHIGQVNFAIGFIAGIKAFTAA
VLGGIGSIPGAMAGGLVLGLCESFATGYVSSDYEDALAFALLVLILIFRPSGILGKPKTQ
KV