Protein Info for DVU0547 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: high-affinity branched chain amino acid ABC transporter, periplasmic branched chain amino acid-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 27 to 364 (338 residues), 203.1 bits, see alignment E=1.5e-63 PF13433: Peripla_BP_5" amino acids 28 to 349 (322 residues), 61.6 bits, see alignment E=1.2e-20 PF01094: ANF_receptor" amino acids 49 to 364 (316 residues), 87.6 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 35% identical to BRAC_PSEAE: Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein (braC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to dvu:DVU0547)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EN0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DVU0547 high-affinity branched chain amino acid ABC transporter, periplasmic branched chain amino acid-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRKGWFKALIAGMTVAVMAGPVFAGDTIKLGVPGAHSGDLASYGLPSANAAKIVAKMFND
KGGINGKMVEVIPQDDQCKPEMATNAATKLVSDGVDIVLGHICSGATKAALPIYKEANKV
VMSPSATTPALTQSGDYPMFFRTISSDDQQAKLGVDFAIDKLGAKKIAVLHDKGDYGKGY
AEYAKQFIEQSGKATVVLFEGVTPGAVDYSAVVQKVRSEGADAVMFGGYHPEASKIVAQM
RKKRMTTPFISDDGVKDDTFIKVAGKDAEGVYASSSKDVSMLPMYKEAIELHKKEFGTEP
GAFYKEAFAAAQALLTAVQRAGSTETPKVVDALRNNFVETAIGKIKFDKRGDAEGTGFSM
YQVKNGVYVELK