Protein Info for DVU0539 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sigma-54 dependent DNA-binding response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF00072: Response_reg" amino acids 9 to 120 (112 residues), 93.5 bits, see alignment E=2.9e-30 PF00158: Sigma54_activat" amino acids 149 to 316 (168 residues), 224.5 bits, see alignment E=2e-70 PF14532: Sigma54_activ_2" amino acids 150 to 320 (171 residues), 67.6 bits, see alignment E=4.4e-22 PF07728: AAA_5" amino acids 173 to 293 (121 residues), 29.3 bits, see alignment E=2.4e-10 PF25601: AAA_lid_14" amino acids 321 to 391 (71 residues), 83.9 bits, see alignment E=1.8e-27 PF02954: HTH_8" amino acids 418 to 456 (39 residues), 27.2 bits, see alignment 7.7e-10

Best Hits

KEGG orthology group: K07715, two-component system, NtrC family, response regulator YfhA (inferred from 100% identity to dvu:DVU0539)

Predicted SEED Role

"Sigma-54 dependent DNA-binding response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EN8 at UniProt or InterPro

Protein Sequence (467 amino acids)

>DVU0539 sigma-54 dependent DNA-binding response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPTTCDEHILIVDDEPDFAHGLARLVSRDFPAASVSVALSGAEALHIIQGSGVALLLTDL
RMPDMDGMELMQQAMTVDPTTSVILLTAHGSIETAVAALKNGAYDFLTKPVRREELQRTL
NKALERIRILKENKRLRQMMQQGCIERQMIGESPVMQRLKETIAAIAATDYSVLIRGESG
TGKELVADMLHRLGSRRERPLVKVNCPSIPDQLLESELFGHVKGAFTGADRTRRGLFMSA
QRGTLLLDEIGDIGEALQTKLLRVLQEREIRPVGSSASTLVDVRIIASTNRALEERIKQG
LFREDLFYRLNVLTIHTPPLRERRDDIPLLADHFVAATCRELSSPVKRISPGALACLAGR
EWPGNVRELQNYIRRLVVFCPGDTIDTAHLRLVDGTTCPTTAETPSLVPYKEAKGAVVED
FTRRYVEGLLRQTGGNISEAARLSGIERVSLQKILRRLGTSGDTFKG