Protein Info for DVU0535 in Desulfovibrio vulgaris Hildenborough JW710

Name: hmcB
Annotation: 40.1 kd protein in hmc operon (HmcB) (voordouw)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 262 to 284 (23 residues), see Phobius details PF13247: Fer4_11" amino acids 105 to 201 (97 residues), 72.4 bits, see alignment E=1.1e-23 PF13237: Fer4_10" amino acids 135 to 192 (58 residues), 26.9 bits, see alignment E=1.3e-09 PF12837: Fer4_6" amino acids 135 to 157 (23 residues), 26.7 bits, see alignment (E = 1.4e-09) PF00037: Fer4" amino acids 136 to 156 (21 residues), 23.4 bits, see alignment (E = 1.4e-08)

Best Hits

Swiss-Prot: 100% identical to HMC2_DESVH: Protein DVU_0535 (DVU_0535) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2406)

MetaCyc: 100% identical to Hmc complex B subunit (Desulfovibrio vulgaris)

Predicted SEED Role

"Iron-sulfur protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33389 at UniProt or InterPro

Protein Sequence (370 amino acids)

>DVU0535 40.1 kd protein in hmc operon (HmcB) (voordouw) (Desulfovibrio vulgaris Hildenborough JW710)
MDRRRFLTLLGSAGLTATVATAGTAKAASTGTFPGYKDSYGVLHDTTRCIGCRKCEQACN
EVNKLPAPKAKFDDLTVLEKTRRTDADSWTVVNRYNAAGLDHPVFRKQQCNHCLEPACAS
ACFVKAFTKNPDGSVTYDGSLCVGCRYCMVACPFNVPAFQYAEAFDPLIQKCTMCHPRLA
EGKLPGCVEICPKEALTFGRRKDLVRIAHDRIRQNPGRYIDHVYGEQEMGGTAWMYLSGV
PFSATGMNEELGTKSAPEYTAGALGAVPMVVGIWPILLTGAYAITKRKEKIAAEEQAEAV
KQAVAASRAEADDKLKAALAKADKDKEAAVTREVKKAVDEARKTFEEELAAKEQPEAPEG
DDAGKPGEDA