Protein Info for DVU0522 in Desulfovibrio vulgaris Hildenborough JW710

Name: yviF
Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF02623: FliW" amino acids 10 to 139 (130 residues), 128 bits, see alignment E=9.2e-42

Best Hits

Swiss-Prot: 100% identical to FLIW_DESVV: Flagellar assembly factor FliW (fliW) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K13626, flagellar assembly factor FliW (inferred from 100% identity to dvu:DVU0522)

Predicted SEED Role

"Flagellar assembly factor FliW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EP7 at UniProt or InterPro

Protein Sequence (173 amino acids)

>DVU0522 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARQNEIEIQTRIGRQRITLDKIIHFPRGLAGFEGRHDFTLLQLREGAPFLVLQSLDDPG
LGLLVADPYSFLTDYQIRVGDPEQRLLKLENIRQVAVLVTVSIPAGQPEKTALNLTGPIL
INHRARIGLQVPQTDASLPPQFYLHMDDANGSTTVRRKASPPAAGEDKGDVQE