Protein Info for DVU0488 in Desulfovibrio vulgaris Hildenborough JW710

Name: purD
Annotation: phosphoribosylamine--glycine ligase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF02844: GARS_N" amino acids 1 to 100 (100 residues), 127.2 bits, see alignment E=5.5e-41 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 419 (419 residues), 537 bits, see alignment E=1.6e-165 PF01071: GARS_A" amino acids 101 to 293 (193 residues), 267.3 bits, see alignment E=1.3e-83 PF02843: GARS_C" amino acids 328 to 419 (92 residues), 106.1 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 55% identical to PUR2_ALLVD: Phosphoribosylamine--glycine ligase (purD) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 100% identity to dvl:Dvul_2453)

MetaCyc: 52% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72ET0 at UniProt or InterPro

Protein Sequence (424 amino acids)

>DVU0488 phosphoribosylamine--glycine ligase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRILIVGSGGREHALAWKLRQSPLVTELFIAPGNGGTALEGTNVPIADDDLPALVAFARE
QKIDLVVPGPELPLVLGLKEALVRENIPCFGPNAYAAQLEGSKAFAKNVMRDAGVPTADF
AVFDEPADARAYVLEKGAPLVVKADGLAAGKGVVVASTTEEAVAALDEIMGRKAYGRAGD
HVVVEECLIGEEASFLCFCDGDTVLPLPSAQDHKAVFDGDKGPNTGGMGAYSPAPVLPAS
RYDEIIEMVIRPVMREMERRGSPFSGILYAGLMMTAAGPKVLEFNVRFGDPECQPLLMRL
DGDLAAIMLACATGRLNEVTLDLKPQTALGVVVAAKGYPGTYPKGMVIEGIQEAEALGDI
KVFQAGTRLEDGHTVSTGGRILCVTALGDDLAAAQRRAYEALAHIRMPDCHFRTDIGAKG
LGRS