Protein Info for DVU0474 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ISDvu4, transposase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF13384: HTH_23" amino acids 8 to 53 (46 residues), 28.8 bits, see alignment 2e-10 PF13518: HTH_28" amino acids 10 to 61 (52 residues), 39.3 bits, see alignment 1.3e-13 PF13551: HTH_29" amino acids 10 to 74 (65 residues), 40.1 bits, see alignment E=7.9e-14 PF00665: rve" amino acids 162 to 266 (105 residues), 40.9 bits, see alignment E=5.2e-14 PF13683: rve_3" amino acids 255 to 320 (66 residues), 49.6 bits, see alignment E=6.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0474)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72AI9 at UniProt or InterPro

Protein Sequence (349 amino acids)

>DVU0474 ISDvu4, transposase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTGKKVARRKLSLLELASELDNVSKACRIMGYSRQQFYEIRRNYQTFGAEGLVDRLPGP
REPHPNRVDEATEDRILAYSLEFPTHGPVRVAQQLVLQGVQVSSGGVRGVWSRNGMLTRH
ERLLRLERHVRDTGIALNDDQVRTLERFSPEFRERHIETRCSGDLVAVDTFFVGTLKGVG
KIYLQSAIDCHSRYAFGRLYTSKLPVTAVHMLNESVLPFFEEHDTPVVTVLSDNGREFCG
RPDRHPYELFLQLENIEHRTTRVRRPQSNGFVERLHRTLLDEHFRIQGRKNWYESLDEMQ
ADLDAYLRHYNHERAHQGRNMSGRTPYQAFLDSRPEGQPKEDNEGHYAA