Protein Info for DVU0461 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: predicted 3-dehydroquinate synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF01959: DHQS" amino acids 12 to 134 (123 residues), 67.9 bits, see alignment E=1e-22 PF26558: DHQS_2nd" amino acids 149 to 322 (174 residues), 235.6 bits, see alignment E=2.6e-74

Best Hits

Swiss-Prot: 50% identical to DHQSH_PERMH: 3-dehydroquinate synthase homolog (PERMA_1476) from Persephonella marina (strain DSM 14350 / EX-H1)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0461)

MetaCyc: 44% identical to dehydroquinate synthase II (Methanocaldococcus jannaschii)
RXN-10032 [EC: 1.4.1.24]

Predicted SEED Role

"3,7-dideoxy-D-threo-hepto-2, 6-diulosonate synthase (EC 4.2.3.-)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.24 or 4.2.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EV7 at UniProt or InterPro

Protein Sequence (323 amino acids)

>DVU0461 predicted 3-dehydroquinate synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRTILFKSVPFSKEAVTLALESGVDGIIVPEKHVAPVQALARCKVLCDDAVCTLELTAKA
DEEEAASRLAAGEDVVLARGWEIIPVENLLARSDRVTVEVASLDEARLAAGILERGVSTV
VVLPQAVTELKAIVQELKLSQGRIDLAPAVVTAVRPVGLGHRVCVDTMSLLRTGQGMLVG
NSSAFTFLVNAETEHNEYVAARPFRINAGAVHAYAVMPGDRTTYLEELRSGSEVLIVGAD
GATTIATVGRLKVEVRPMLLVEARVGDTVGAVFLQNAETIRLVRADGTPVSVVALREGDE
VLCRTDVAGRHFGMRITEDIREA