Protein Info for DVU0448 in Desulfovibrio vulgaris Hildenborough JW710

Name: gmd
Annotation: GDP-mannose 4,6-dehydratase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 TIGR01472: GDP-mannose 4,6-dehydratase" amino acids 2 to 362 (361 residues), 582.1 bits, see alignment E=1.9e-179 PF04321: RmlD_sub_bind" amino acids 3 to 161 (159 residues), 29.6 bits, see alignment E=5.7e-11 PF01370: Epimerase" amino acids 4 to 251 (248 residues), 248.7 bits, see alignment E=8.1e-78 PF16363: GDP_Man_Dehyd" amino acids 5 to 355 (351 residues), 502.1 bits, see alignment E=1.3e-154

Best Hits

Swiss-Prot: 70% identical to GM4D_VIBCL: GDP-mannose 4,6-dehydratase (gmd) from Vibrio cholerae

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to dvl:Dvul_2488)

MetaCyc: 68% identical to GDP-D-mannose 4,6-dehydratase (Vibrio cholerae O1)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EX0 at UniProt or InterPro

Protein Sequence (381 amino acids)

>DVU0448 GDP-mannose 4,6-dehydratase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKRALITGITGQDGAYLAEFLLAKGYEVHGIKRRASLFNTDRIDHLYQDPHEKRRRFILH
YGDMTDASNLIRIVQEVQPDEVYNLAAQSHVKVSFELPEYTANVDALGPLRLLEAIRILG
LEKSTRFYQASTSELFGLVQEVPQTERTPFYPRSPYACAKLYAYWIAVNYREAYGMYACN
GILFNHESPVRGETFVTRKITRALARTVLGLTNGLHLGNLNALRDWGHARDYVEMQWLML
QQDKPEDFVIATGHQYSVRDFVATAAGELGLALEWHGEGVDEKGVVTSVDAKALERLTGA
AGASCPVKPGDVLVQVDPRYFRPTEVETLLGDPTRAHERLGWKPRTTFADMVAEMVREDV
NLARRDAVCKVAGFRAFSYNE