Protein Info for DVU0438 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: AcrB/AcrD/AcrF family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1041 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details amino acids 431 to 454 (24 residues), see Phobius details amino acids 463 to 490 (28 residues), see Phobius details amino acids 530 to 549 (20 residues), see Phobius details amino acids 856 to 876 (21 residues), see Phobius details amino acids 883 to 903 (21 residues), see Phobius details amino acids 909 to 932 (24 residues), see Phobius details amino acids 958 to 977 (20 residues), see Phobius details amino acids 989 to 1013 (25 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 1013 (1010 residues), 1090.3 bits, see alignment E=0 PF03176: MMPL" amino acids 329 to 489 (161 residues), 33.3 bits, see alignment E=3.9e-12 PF02355: SecD_SecF_C" amino acids 337 to 478 (142 residues), 22.5 bits, see alignment E=1e-08

Best Hits

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 100% identity to dvu:DVU0438)

Predicted SEED Role

"RND multidrug efflux transporter; Acriflavin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EY0 at UniProt or InterPro

Protein Sequence (1041 amino acids)

>DVU0438 AcrB/AcrD/AcrF family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNVTEFFIRRPVTTTLVMLGLLFFGVMGYRQLPVSDLPNVDFPTIQVRAQLPGADPETMA
SSVAAPLERQFATIAGIDSMSSTNTQGNTRITIQFNLSRDIDAAAQDVQAAISTAQRKLP
SDLTTPPSYQKVNPADQPILFLALTSPTLPLSKVNEYAETRIGQTISMVSGVAQVNVYGA
KKYAVRVQVDPRRLKALGLGIDEVSAAVDKANSNLPTGTLQGEHTASIIKASGQLYDAAA
YRPVVVAYRNGAPVRLEELGRVVDSVEQDRILNWFNDERGIVLAVQRQPGTNTVEVVESI
KRLLPEFERQLPAAVKLNILFDRSESIKASVAEVKFTLVLTVCLVVLVIFLFLRSLSATV
IPSLALPMSVVVTFAAMHMMGFSLDNLSLMALTLAVGFVVDDAIVMLENIVRHMEMGKTP
LRAALDGAREIGFTIISMTVSLAAVFIPVLFMGGIVGRLFHEFAVVITVAILLSGFVSLS
LTPMLCALFLKPHVGQRRHGRVYNALETFFETLHRGYERSLRFTMRHHRMTFGLSMVVLG
VTVWLFAAMPKGFLPSEDTGQISGFTEADQSVSFGQMVKLQKTLHPIIAADPGVDSFSST
VGAGGPNVGGNSGRFFIRLKDFDERDEHVDTIINRLRAKLSGFPGINVFLVNPPSINVGG
RASKSLYQYTLQGPDTAELYKAGTELEAALRELPQLRDVTSDLQIRNPEVRVDIDRDKAA
ALGLSVHQVEDALQSAYGTRQVSTILAPDNDYQVILELLPEYQRDASSMSLLNVRSASGR
LVPLDTIATLRPSVGPLAVNHSGQFPSVTLSFNLRPGVSLSEAVQAVEGIAGQYLPPTAT
GTFQGTAQAFQSSMQGMAMLLFMAVVVIYIVLGVLYESFIHPLTILSGLPSAGLGALVTL
FIFGIDLNLYAFVGIIMLIGIVKKNAIMMIDFAVEAERKNGASPYEAILQGCLIRFRPIM
MTTMAALMGTLPIAVGWGPGAEARQPLGLAVVGGLLVSQLLTLYITPVYYTYLDALSRRI
KRRMGRVAQDVEAVASGGDGA