Protein Info for DVU0437 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: efflux transporter, RND family, MFP subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 80 to 404 (325 residues), 251.2 bits, see alignment E=6.2e-79 PF16576: HlyD_D23" amino acids 93 to 324 (232 residues), 56.1 bits, see alignment E=4.8e-19 PF13533: Biotin_lipoyl_2" amino acids 105 to 150 (46 residues), 31.8 bits, see alignment 1.4e-11

Best Hits

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 100% identity to dvu:DVU0437)

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72EY1 at UniProt or InterPro

Protein Sequence (486 amino acids)

>DVU0437 efflux transporter, RND family, MFP subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNGLSCCFRAAEGFRTVQTATNGTTMNDHSAMRAVSSFSTMASVRRVACTLLACCLVVAG
ACSRDEGKAKGARAKGPAPVTAAVAARQDIPVRLKAVGNVEASATVQVRSRITGELTGIH
FREGDDVRKGQKLFTIDPRPMEAALREARARQERTRAQLTKAEDDLRRFASLVEGGFVSR
EQYEQIRTTAEGLRASLREAEAAVESAALQRDYCIITAPADARAGAVGAHIGNMIKANAD
DWLVTLDTVEPVYVSFSIPEVHLPAVLALRQSGTGRVLARPDGGDEVEGRLDFVDNSVDT
ATGTIRLRATFDNRTRSLWPGRFVDVRLTLATHKDAVVVPSRAVQAGVDGPYAYVVADGR
AELRNLAVGVQADTMTEVLQGIAPGEKVVVEGLMRLTPGAEVVIRAADAGRNATASPADT
TATPGGPSGDTPPGGASKSAGAAAEKGAADTATDSKQAGGNAAQTSVPTQGPTQGPTGTK
AAEARQ