Protein Info for DVU0416 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GGDEF domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 193 to 354 (162 residues), 162.9 bits, see alignment E=2.8e-52 PF00990: GGDEF" amino acids 197 to 352 (156 residues), 157.9 bits, see alignment E=9.8e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2518)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F02 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DVU0416 GGDEF domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRTLIDRVFSNGLSHAPQPEAIHHVGVANMFNAVTMVFCLSLAFFDWMQGYGGMALLLCG
IAALALFSMLHLGRTGKRSNINLLLALALIGVDWWLMATGGVAGMGHLWVFSLPPLLLFT
FGLRRGGMLVALLVFGIICILYGPEELSPFEYGDSFAPRYLLALTASISLVSVAEAARRH
SERRLLALTHQLAFCARSDPLTGLANRRSLCERFEQERQRSLRNNTPLSLILCDIDHFKT
INDTHGHECGDYVLRKLADMLRTNMRAQDTVCRWGGEEFLLLLPDTDEKGATRLAEKLRT
LTESYPFSYHGIPIRVTLCFGVHQCSREGHTDYHIRKADRKLYMAKEQGRNRVVSGDIPD
ILLPPGYIEEAD