Protein Info for DVU0413 in Desulfovibrio vulgaris Hildenborough JW710

Name: trk1
Annotation: potassium uptake protein, TrkH family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 379 to 396 (18 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details PF02386: TrkH" amino acids 30 to 424 (395 residues), 215.7 bits, see alignment E=5e-68

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to dvl:Dvul_2521)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F05 at UniProt or InterPro

Protein Sequence (445 amino acids)

>DVU0413 potassium uptake protein, TrkH family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAYHKHFGPLALPVLSFAAVILAGAVLLTLEACGTGKAVSFVDALFTATSAVCVTGLAVV
DTGTTYSTMGQMVILALIQLGGLGITTYSSLIFFLWRRRVSITDRLAVGQALLHDPSFHL
GTFLQRVVVVVLCIEFSGAAALFIFGEGRIDVYAAIFHAISAFCNAGFGLMPDNLVSFRD
NVGVNATIMLLIIFGGLGFSVLDECLSALRDRSVRLSRHSRLVLRTSALLIVGGAAAIWC
IEAWRSGNGMSRADLVLPALFQSVSARTAGFNTIDLGAVTHTTLLVIIFLMFVGGSPGSC
AGGIKTTTFRVLAGFVTAQFKGRRQIILMDRAVDRATIEKALTLFLFATLTVVGGVTILT
LTTDAVVDPSAPRFDFIDLLFETVSAFGTVGLSTGVTPHLTTGGKLCITLIMFVGRLGPL
WLLTTLQSLQTEPKYRWPEMDMPIG