Protein Info for DVU0412 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: potassium uptake protein TrkA, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF03446: NAD_binding_2" amino acids 7 to 87 (81 residues), 24.1 bits, see alignment E=6.5e-09 PF02254: TrkA_N" amino acids 9 to 123 (115 residues), 95.6 bits, see alignment E=5.3e-31 PF02080: TrkA_C" amino acids 161 to 220 (60 residues), 39.6 bits, see alignment E=7.8e-14

Best Hits

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 100% identity to dvu:DVU0412)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F06 at UniProt or InterPro

Protein Sequence (221 amino acids)

>DVU0412 potassium uptake protein TrkA, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MATPKLEIGVIGLGKFGLQVSRTLVELGHSVVGIDSTEGRIRQAQDILSQVYQGNAADPA
VLQQLRFQDLDCVIVSVGNSMETSLLVTLNLQEIGVRKIWVKAVSTEHKKVLTRLGVDHV
ILPEHDVATHLAHRLVNPGMLDLLPLGGGGQILLQELTVDKWAGRTLLDLRLANEHGVMV
VAVKPAAFREYRFVPAAHEVLQQGDKLVVIGRHEDVLRLEP