Protein Info for DVU0407 in Desulfovibrio vulgaris Hildenborough JW710

Name: rlpA
Annotation: rare lipoprotein A family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03330: DPBB_1" amino acids 31 to 119 (89 residues), 92.2 bits, see alignment E=2e-30 TIGR00413: rare lipoprotein A" amino acids 33 to 127 (95 residues), 140.6 bits, see alignment E=3.3e-45 PF05036: SPOR" amino acids 134 to 207 (74 residues), 32.6 bits, see alignment E=8.4e-12

Best Hits

KEGG orthology group: K03642, rare lipoprotein A (inferred from 100% identity to dvl:Dvul_2527)

Predicted SEED Role

"RlpA-like protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F11 at UniProt or InterPro

Protein Sequence (214 amino acids)

>DVU0407 rare lipoprotein A family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIKRLTAAVVCLAILLAHVAPASASNSGIRKQGKASWYGEEQHGLPTASGEDFDMKAFTA
AHRKLPLGSVVKVTNVRNGRSVLVTVNDRGPYAGNRIIDLSYVAASRLGMVRQGVASVKL
DVMANADGTPIHSGKAFYIDIRRFAYKSDALRLVRSLEKTGLASARAVRLEGTSNKAWMV
AVGPFRNFHDAAGVRSTLQRKQPQSEIILERGDL