Protein Info for DVU0405 in Desulfovibrio vulgaris Hildenborough JW710

Name: cobB-1
Annotation: cobyrinic acid a,c-diamide synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 5 to 454 (450 residues), 397 bits, see alignment E=5.8e-123 PF13500: AAA_26" amino acids 5 to 182 (178 residues), 49.3 bits, see alignment E=8.1e-17 PF01656: CbiA" amino acids 6 to 190 (185 residues), 57.8 bits, see alignment E=1.7e-19 PF07685: GATase_3" amino acids 251 to 438 (188 residues), 108.9 bits, see alignment E=3.9e-35

Best Hits

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to dvu:DVU0405)

MetaCyc: 41% identical to siroamide synthase subunit (Allochromatium vinosum)
6.3.5.M1 [EC: 6.3.5.M1]

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.-, 6.3.5.9

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9 or 6.3.5.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F13 at UniProt or InterPro

Protein Sequence (468 amino acids)

>DVU0405 cobyrinic acid a,c-diamide synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSARLVIAGLNGGTGKTILSLGTVRALTNAGHSVKPFKKGPDYIDAEWLGLAAGRAATN
LDPFFLDAARLQSLFLHASAGASISIIEGNRGLYDGRDVTGSCSTAELARILDSPVVLAM
DCTKMTRTAAAILSGVAAFEPGVKLAGVVLNRTANERHRSMLRQCIEHYTDIPVLGALPR
LRDNPIPERHMGLVSDREFAQCAGELDRVAQFVAQHVDVERMAEIARSAQPLASNEPFWP
VVAEGDGVRPRIGYVRDAALWFYYEENLEALRQAGADLVELRIIDGDPWPTLDGLYLGGG
FPETLASELSACRERLAGIREAALAGLPVYAECGGFMVLGESIVMDGVEYPMSGVFPVQT
VFHPKPQGLGYVEAEVVAENPFFPQGMVFRGHEFHYSACRPRDGGAVTHALRLNPGTGMG
GGADGLVQANTFAAYTHIFGPAVQGWAERFVRAARGHRDQLNKGTDLS