Protein Info for DVU0398 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HMGL-like domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00682: HMGL-like
  • amino acids 53 to 304 (252 residues), 105.2 bits, E=6.3e-34
• PF02743: dCache_1
  • amino acids 483 to 593 (111 residues), 49.6 bits, E=6e-17
• PF22673: MCP-like_PDC_1
  • amino acids 495 to 591 (97 residues), 43.5 bits, E=5.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2536)

Predicted SEED Role

"Re face-specific citrate synthase (EC 2.3.3.3)" (EC 2.3.3.3)

MetaCyc Pathways

• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• glyoxylate cycle (4/6 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (18/26 steps found)
• partial TCA cycle (obligate autotrophs) (5/8 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• TCA cycle I (prokaryotic) (6/10 steps found)
• TCA cycle III (animals) (6/10 steps found)
• TCA cycle II (plants and fungi) (5/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (5/9 steps found)
• superpathway of glyoxylate bypass and TCA (7/12 steps found)
• nitrogen remobilization from senescing leaves (4/8 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (14/22 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (5/14 steps found)
• methylaspartate cycle (6/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.3

Sequence Analysis Tools

See Q72F17 at UniProt or InterPro

Protein Sequence (608 amino acids)

>DVU0398 HMGL-like domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLLHLNRASTRVRLENRDNPELYRDIFPYSKISRVEFDDIFLMPRPAEPMFITDTTFRD
GQQARPPYTVKQMAHMYDLLHKLGGRSGLIRASEFFMYSQKDRRAIEACRAKGYKFPRIT
GWIRANVDDLKIARDMEFDEVGMLTSVSDYHLYLKLGLDREKALQNYLKVVGQALEWGII
PRCHFEDITRADIPGFCLPFAQKLMEMSKDSGLPVKIRLCDTMGYGVPYPGATLPRSVQR
IVRAFTDEAGVPGEWLEWHGHNDFHKVLINGVTAWMYGCAGVNCTLLGFGERTGNTPLEA
LVIEYISLTGDDDAAETQVISEIAHYFETELDYRIPDNYPFVGKDFNATSAGIHVDGLAK
NEEIYNIFDTRKILNRPVPIIITDKSGRAGVAYWINQYLGLPVENQVSKKHPAVGHIYNK
IMKAYEDGRNTSFSNKEMQTLVRRFMPELFGSEFDQIKKMAGELSAGLIIKLAKECQIMG
VGDDKYPCMREFVQEYPFIQYLYLTDNRGKLLSAAITDPAYQAKYDQLPIGYDFSNRQWF
IRPMQTGELHITDVYQSQFTGQLILTVSTAVTDEHDNITGIIGADIQIEQLLRRADAIED
DVAQDEDE