Protein Info for DVU0378 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: thioredoxin, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF00085: Thioredoxin" amino acids 21 to 99 (79 residues), 45.6 bits, see alignment E=1.5e-15 PF13728: TraF" amino acids 22 to 97 (76 residues), 27.7 bits, see alignment E=6.1e-10 PF13098: Thioredoxin_2" amino acids 22 to 101 (80 residues), 32.7 bits, see alignment E=2.1e-11 PF00462: Glutaredoxin" amino acids 23 to 78 (56 residues), 33.3 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: K03671, thioredoxin 1 (inferred from 100% identity to dvl:Dvul_2555)

Predicted SEED Role

"FIG00605593: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F37 at UniProt or InterPro

Protein Sequence (104 amino acids)

>DVU0378 thioredoxin, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEA
RPELMKELGFERVPTLVFIRDGKVAKVFSGIMNPRELQALYASI