Protein Info for DVU0375 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: Glu/Leu/Phe/Val dehydrogenase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF02812: ELFV_dehydrog_N" amino acids 26 to 115 (90 residues), 46.7 bits, see alignment E=2.6e-16 PF00208: ELFV_dehydrog" amino acids 184 to 393 (210 residues), 94 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_2558)

Predicted SEED Role

"Glu/Leu/Phe/Val dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F40 at UniProt or InterPro

Protein Sequence (409 amino acids)

>DVU0375 Glu/Leu/Phe/Val dehydrogenase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKDLLNAFENKAPEIVFEWHDAETDATGWAVINSLRGGAAGGGTRMRKGLDKHEVVSLAK
TMEIKFAVSGPHIGGAKSGINFDPADPRKNDVLNRWYKAVMPLLKSYYGTGGDLNVCEIK
DVIPNTEEYGLWHPQEGIVNGHFHPSEELRIQKICQLRGGVTMPVVNPAYTPDPAKKYLV
ADLITGFGVSESVRHYYEIKGDSVAGKRVIVQGWGNVGGTAAYYLAANGAKVVGIIDRAA
GLVSTEGLTFEQVKELLAKRVGNTLTGDNLLSAEDTQKLVWSVGADVFLPCAASRLVTRE
QVATLKDNGLGLIACGANVPFRDDNIFYGPTAEYADGVVDVIPDFIANCGMARAFNYLMS
SKVDLDESAIFQDVSEVIRNALTESCAAATGKNHLLAASLKTVLHKLMH