Protein Info for DVU0357 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details PF13578: Methyltransf_24" amino acids 129 to 229 (101 residues), 56.7 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to dvl:Dvul_2627)

Predicted SEED Role

"Mll7338 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F57 at UniProt or InterPro

Protein Sequence (305 amino acids)

>DVU0357 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MFNPVGRRVHNEAGMTDPRYMALLLDIAARKERGALLEVDDPYPWQPRPRWGHGNAPHAA
LRDLFDARRSEYIPLLDAMVAHAGRFAAIRRDFDASAPHEPHWDNGWLPSLDGMSIYTLL
AQMRPSRFVEVGSGNSTRFAARAIRDCGLATRIVSIDPAPRAEVDRLCHEVVRAPLENVD
MAFFDTVTADDLVFVDCSHRAQQNSDVTVFFLEMLPRLPVGCVVGIHDICLPLDYPPGWE
GRYYNEQYMLATLLLFGAERFSLLLPGYHVSTTPDLAARLAPLAALPGLAGLPCAGSVFW
MRKRA