Protein Info for DVU0351 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: cytidine 5monophosphate N-acetylneuraminic acid synthetase, putative/polysaccharide biosynthesis protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 PF02348: CTP_transf_3" amino acids 20 to 138 (119 residues), 24.1 bits, see alignment E=4.4e-09 PF12804: NTP_transf_3" amino acids 26 to 161 (136 residues), 28.6 bits, see alignment E=2.2e-10 PF04101: Glyco_tran_28_C" amino acids 367 to 467 (101 residues), 26.5 bits, see alignment E=9.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0351)

Predicted SEED Role

"N-Acetylneuraminate cytidylyltransferase (EC 2.7.7.43)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.7.7.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F63 at UniProt or InterPro

Protein Sequence (544 amino acids)

>DVU0351 cytidine 5monophosphate N-acetylneuraminic acid synthetase, putative/polysaccharide biosynthesis protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDTRRCVVIPAVKKNAVIPDQLVKRLAGVTLIQRAIDTAKALAPGDDIVVVTDSQEIAL
ICERNGVRHVCNPGLHLATLDIVRELRGVLEDLARSYGHIVIYRASCPLLTADDIEDAYA
TFLREGADCLVTVKSVRHRVWEKRNGGLDALLSQDETEPSIYVESKALVMLDASALTRGE
VRKVVPYFLNDRAIEINSYQDWWICEKLLCRKHIVFVVAGYPAIGMGHIFRALMLAHEVA
DHRITFLCTRESELAASNIAARDYRTRVQQGDDLAADVLSLRPDLVINDILNTDADYVGR
LREAGVRVVNFEDEGPGAHLADLVVNALYEEKVDDPRFLHGHRFFCLRDEFVNGVRNDYR
DPVRCVLVTFGGTDHSDFSRGTLDAIEPLCRERGITIRLVAGPGYAHKDAMQEHVERLGS
PLVEFTYATNVMSRMMEGADLAICSAGRTVYELAHMRVPAIVMAHHEREGRHTFARGRNG
FAYLGVMEHFDGAKLTRVFTQLLDAGNRRRLFDRQARFDFIRNKADVVRRITALLDDTPA
PENA