Protein Info for DVU0350 in Desulfovibrio vulgaris Hildenborough JW710

Name: spsF
Annotation: spore coat polysaccharide biosynthesis protein spsF (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF02348: CTP_transf_3" amino acids 4 to 125 (122 residues), 82.2 bits, see alignment E=4.9e-27 PF12804: NTP_transf_3" amino acids 10 to 135 (126 residues), 37.8 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K07257, spore coat polysaccharide biosynthesis protein SpsF (inferred from 100% identity to dvl:Dvul_2634)

Predicted SEED Role

"Spore coat polysaccharide biosynthesis protein SpsF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F64 at UniProt or InterPro

Protein Sequence (227 amino acids)

>DVU0350 spore coat polysaccharide biosynthesis protein spsF (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKTVALIQARLGSSRLPCKMMLSLHGLPVIDWVVRRVRRATLVDEVVVATSTQPENDILE
HHLSRQGVAVFRGPEDDVLERFRLAGAAYGAEQVVRVCADNPLIWGGAIDDLIRFWRAEG
CDYAYNHIPRGNLYPDGLGAETLSFALLEEVAREATLPEHREHCLSFIWAHPERYTIRTF
DPADPALHRPDLKLDMDTPADYRYLALMDIHPDITPEELVAMLPRTA