Protein Info for DVU0340 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: acetyltransferase, CysE/LacA/LpxA/NodL family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF14602: Hexapep_2" amino acids 140 to 174 (35 residues), 29.2 bits, see alignment 6.3e-11 PF00132: Hexapep" amino acids 140 to 174 (35 residues), 36.8 bits, see alignment 2.1e-13

Best Hits

KEGG orthology group: K00633, galactoside O-acetyltransferase [EC: 2.3.1.18] (inferred from 100% identity to dvu:DVU0340)

Predicted SEED Role

"Galactoside O-acetyltransferase (EC 2.3.1.18)" in subsystem Lactose utilization (EC 2.3.1.18)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F74 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DVU0340 acetyltransferase, CysE/LacA/LpxA/NodL family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARCAVFLEELWFALFAWVPTVLGTAVRLVAWRPLFRLLGGVCGKVRFGQSLTLQGAGHM
RLADGVRLGKGCHLYARTGELVMGENAALNINVVVDADGGTVRIGAHATVGPGTVIRAAN
HRFDRLDTPIMFQGHEYGEVVIDDDVWIAANCTVVPGVHIGRGAVVGAGAVVTKDVEPYT
VVAGVPARFIRRRGPAE