Protein Info for DVU0328 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glycosyl transferase, group 1 family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF13477: Glyco_trans_4_2" amino acids 3 to 153 (151 residues), 44.3 bits, see alignment E=7e-15 PF13439: Glyco_transf_4" amino acids 21 to 154 (134 residues), 30.1 bits, see alignment E=1.7e-10 PF13579: Glyco_trans_4_4" amino acids 21 to 169 (149 residues), 46.9 bits, see alignment E=1.4e-15 PF20706: GT4-conflict" amino acids 189 to 362 (174 residues), 35.5 bits, see alignment E=2.1e-12 PF00534: Glycos_transf_1" amino acids 194 to 348 (155 residues), 91.1 bits, see alignment E=2.2e-29 PF13692: Glyco_trans_1_4" amino acids 196 to 336 (141 residues), 97.9 bits, see alignment E=2.3e-31 PF13524: Glyco_trans_1_2" amino acids 219 to 365 (147 residues), 30.9 bits, see alignment E=8.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0328)

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F86 at UniProt or InterPro

Protein Sequence (381 amino acids)

>DVU0328 glycosyl transferase, group 1 family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNVAILGNQARAMVNFWSVFIARLQADGHTVVCIIPPGDAEGDAALTSMGVRVRHYPLDR
KGLNPVRDVATFAALYRIFRQERPDRLFCFTIKPVIYGATAAALARVPGRVAMITGLGYM
FEADTPVKRLLNRVAVLMYRAALACVHTVFFQNEEDRAVFTAKGIVPAGTEVAMSRGTGV
ALDHFAPAETVTAPVTFLLVGRLIEAKGLYEYAEAARMLKARHPEARFRVLGPPEQGLGS
VPMETINQWHREGVIEYMGQTRDVRPFLREASVVVLPSWREGTPCSVMEGMSMARAAIVT
DAPGCREVVEDGVNGFMVPLRSPEALAAAMERFIEDPSLVQRMGRAGRDLAEREFDAEKV
AAHIMRVMRLDAAPRAGGNPQ