Protein Info for DVU0321 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: transcriptional activator, putative, Baf family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00671: pantothenate kinase, type III" amino acids 5 to 255 (251 residues), 152.6 bits, see alignment E=7.7e-49 PF03309: Pan_kinase" amino acids 5 to 211 (207 residues), 193.2 bits, see alignment E=2.6e-61

Best Hits

Swiss-Prot: 100% identical to COAX_DESVV: Type III pantothenate kinase (coaX) from Desulfovibrio vulgaris subsp. vulgaris (strain DP4)

KEGG orthology group: K03525, type III pantothenate kinase [EC: 2.7.1.33] (inferred from 100% identity to dvu:DVU0321)

Predicted SEED Role

"Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72F93 at UniProt or InterPro

Protein Sequence (262 amino acids)

>DVU0321 transcriptional activator, putative, Baf family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARHLLLFDIGNTNVKVGIATEGTVLTSYALPTDGTQTGDGFGLALLDIMRHAGLGADDI
DACVGSSVVPSLDPLLRHACERFLWRPLQLAHVDLPVPLENRYERPTEVGADRLVAAFAA
RRLYPDARALVSVDFGTATTFDCVDGDAYLGGLICPGVLSSAGALSSRTAKLPRVSLEVS
EDMPVVGRSTTTSLNHGFIFGFAALAEGVTARLRKVLPEPLEVVATGGFARAVARVSDCF
DHVRPDLLLEGLRLLYLESEQR