Protein Info for DVU0319 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: NAD-dependent epimerase/dehydratase family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 18 to 263 (246 residues), 192.3 bits, E=2.4e-60
• PF01073: 3Beta_HSD
  • amino acids 19 to 251 (233 residues), 65.9 bits, E=7.8e-22
• PF16363: GDP_Man_Dehyd
  • amino acids 19 to 330 (312 residues), 171.1 bits, E=1.2e-53
• PF02719: Polysacc_synt_2
  • amino acids 19 to 244 (226 residues), 43.6 bits, E=5.7e-15
• PF07993: NAD_binding_4
  • amino acids 20 to 149 (130 residues), 27 bits, E=6.2e-10

Best Hits

Swiss-Prot: 61% identical to VIPB_SALTI: Vi polysaccharide biosynthesis protein VipB/TviC (vipB) from Salmonella typhi

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to dvl:Dvul_2662)

MetaCyc: 69% identical to UDP-N-acetylglucosamine C4-epimerase subunit (Pseudomonas aeruginosa)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; 5.1.3.- [EC: 5.1.3.7]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-N-acetyl-α-D-galactosaminuronate biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• UDP-sugars interconversion (4/9 steps found)
• stachyose degradation (2/7 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

See Q72F95 at UniProt or InterPro

Protein Sequence (341 amino acids)

>DVU0319 NAD-dependent epimerase/dehydratase family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTFDSVLQDINASPRTWLVTGVAGFIGSNLLETLLRQGQRVVGLDNFLTGYQRNLDMVR
DLVGEERWASFRFIEGDIRDLATCHEACKGVDHVLHQAALGSVPRSIDDPILSNECNITG
FVNMLVAARDAGAKSFVYAASSSTYGDEPTLPKVEDIIGKPLSPYAVTKYVNELYADVFA
RCYGFTAIGLRYFNVFGQRQDPFGAYAAVIPQWFASLLRGETVFVNGDGETSRDFCYIDN
VVQANILASLAPAEARDKVYNVAFGQRTTLNELFDLIREEVVRHKPEAAGATCVHRDFRA
GDVRHSLADITRAQTLLGYAPVYDVREGLRLAGDWYAANLK