Protein Info for DVU0296 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: peptidase, M24 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01321: Creatinase_N
  • amino acids 9 to 139 (131 residues), 90.8 bits, E=1.1e-29
• PF00557: Peptidase_M24
  • amino acids 147 to 350 (204 residues), 217.5 bits, E=1.8e-68

Best Hits

KEGG orthology group: K01262, Xaa-Pro aminopeptidase [EC: 3.4.11.9] (inferred from 100% identity to dvl:Dvul_2684)

Predicted SEED Role

"Aminopeptidase YpdF (MP-, MA-, MS-, AP-, NP- specific)" in subsystem Protein degradation

MetaCyc Pathways

• glutathione degradation (DUG pathway) (1/2 steps found)
• γ-glutamyl cycle (1/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.9

Sequence Analysis Tools

See Q72FB8 at UniProt or InterPro

Protein Sequence (356 amino acids)

>DVU0296 peptidase, M24 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MDNIRFEARREKLRAAMRERGLAALFVSHDANRYYLSGFELHDPQTNESAGYVLVTADGR
DWICTDSRYLDAARRIWDNERIFIYGADAPAQMNTLIRDHVRGTVGFEARSVSLEFFEKL
SPGLAMERVDGLVEAQRIIKEPEEIEVMERSCALNHRLMEWVPSILRPGRTEAEVAWDIE
SFFRSNGASELSFASIVAVGPNGALPHHRGGRDVITDNCSVLVDVGARLDEYCSDQTRTF
WVGDKPADHFVRALEQTQTAQAKAIAAMHPGMRACDAYKVARDHFESVGVAAHFTHALGH
GIGLETHEPPSLNPRNEMVLKPGMVVTVEPGLYYPEWGGIRWEYMVLVTEDGVRAL