Protein Info for DVU0279 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sulfate permease family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 337 to 367 (31 residues), see Phobius details amino acids 387 to 417 (31 residues), see Phobius details TIGR00815: sulfate permease" amino acids 23 to 549 (527 residues), 398.1 bits, see alignment E=3e-123 PF00916: Sulfate_transp" amino acids 30 to 393 (364 residues), 300.2 bits, see alignment E=2e-93 PF01740: STAS" amino acids 445 to 549 (105 residues), 59.2 bits, see alignment E=3.1e-20

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to dvl:Dvul_2701)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FD5 at UniProt or InterPro

Protein Sequence (568 amino acids)

>DVU0279 sulfate permease family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAIPSGATGKEPFLPRTLTVLREGYDGGTFFKDLAAGLTVGIVALPLAMAFAIASGTTPE
RGLFTAIVAGFLISLLGGSRYQIGGPTGAFVIIIFNVIMKHGYDGLVVTTLLAGAMLLVF
GLCRFGALIKYIPYPVTTGFTAGIAVLIFSQQVKDFLGLSMQSVPPDFFEKWQAYIHNAA
TFDPATCGIAFLALGAIILTRKTIPRIPGPVVGVVLASLTVWALGLDVETIGSRFGGIPT
ELPTFTLPTVTLERVRQLLPDAMTIALLAGIESLLSCVVADGMTGDKHNSNVELAAQGAA
NIASVMFGGIPATGAIARTVTNIRSGGRTPVAGMIHAAVLVGFILYLAPLASFIPLASLA
AVLMVVAWDMSEMHKFLRLLHAPKSDVLVMCLTFALTVVIDLTVAVYVGVMLASLLFMRR
MSEVTQICTCLDGEATKVQGRETAELDVPEGVKVYEIDGPFFFGVADRFQNVLAALDRQP
EVFILRMRKVSTLDSTAVNALEVFWRKCRSDGTQLLLSGVRETMRTTLRRMGTLSLIGEG
NICENIDAALARAGQVLAERREAEDRPQ