Protein Info for DVU0259 in Desulfovibrio vulgaris Hildenborough JW710

Name: divK
Annotation: DNA-binding response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 transmembrane" amino acids 75 to 92 (18 residues), see Phobius details PF00072: Response_reg" amino acids 5 to 113 (109 residues), 82.2 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 40% identical to RRF1_DESVH: Protein rrf1 (rrf1) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU0259)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72FF5 at UniProt or InterPro

Protein Sequence (129 amino acids)

>DVU0259 DNA-binding response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MAYKILVVDDDPYIVKYMVDILSDNGYATCSASDGSEALDVLRREKPDLVTLDLEMPNEW
GPRFYRKMTREDEFRNVPVIVISGLSGIHLAIRNAVASLKKPFDPNKLLEIIRQTLENPE
GIRSAEGEH